PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010523346.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 25843.4 Da    PI: 9.6021
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010523346.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.7e-29959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i+n + rqvtfskRr gi+KKAeELSvLCdaeva+iifs tgkl+e+ss
  XP_010523346.1  9 KKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSS 59
                    68***********************************************96 PP

2K-box58.92.2e-20871711599
           K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     +  + +la+L k ie   r++R+l GedL+ Lsl +Lq+Le+ +e++l ++R+kK e ++ +i+ l ++  el+een++Lr++l+
  XP_010523346.1  87 QPENSNLARLSKDIEDKTRQLRQLRGEDLQGLSLDDLQRLEKLVESGLGRVREKKGERVMGEISSLERRGAELEEENNNLRQRLM 171
                     55577899**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.997161IPR002100Transcription factor, MADS-box
CDDcd002658.36E-38269No hitNo description
SuperFamilySSF554553.92E-30371IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-26323IPR002100Transcription factor, MADS-box
PfamPF003199.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.05786176IPR002487Transcription factor, K-box
PfamPF014861.5E-1790170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MAREKIRIKK IDNVTARQVT FSKRRRGIFK KAEELSVLCD AEVALIIFSA TGKLFEFSSS  60
RMRDILARYN LHASNLNKLN PPLALQQPEN SNLARLSKDI EDKTRQLRQL RGEDLQGLSL  120
DDLQRLEKLV ESGLGRVREK KGERVMGEIS SLERRGAELE EENNNLRQRL MMLERGKTAA  180
FREGETVAGV QEGMSLESAV TTNVSSSSSA SPLDDDFSDT SLKLALPFSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-18269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-18269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-18269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-18269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-18269168Myocyte-specific enhancer factor 2A
3p57_I3e-18269168Myocyte-specific enhancer factor 2A
3p57_D3e-18269168Myocyte-specific enhancer factor 2A
3p57_C3e-18269168Myocyte-specific enhancer factor 2A
3p57_B3e-18269168Myocyte-specific enhancer factor 2A
3p57_A3e-18269168Myocyte-specific enhancer factor 2A
3kov_J3e-18269168Myocyte-specific enhancer factor 2A
3kov_I3e-18269168Myocyte-specific enhancer factor 2A
3kov_B3e-18269168Myocyte-specific enhancer factor 2A
3kov_A3e-18269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523346.11e-164PREDICTED: MADS-box protein AGL24 isoform X1
RefseqXP_010523347.11e-164PREDICTED: MADS-box protein AGL24 isoform X1
SwissprotO827941e-103AGL24_ARATH; MADS-box protein AGL24
TrEMBLV4LW031e-110V4LW03_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.7__1822__AT4G24540.11e-102(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24540.16e-84AGAMOUS-like 24